PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_30414
Common NameKK1_034760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 153aa    MW: 17563.8 Da    PI: 11.5788
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_30414genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-172368147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd +l  +v+ +G+++W++I+r++  gR++k+c++rw + 
    C.cajan_30414 23 KGPWSAEEDRILTWLVEAHGPRNWALISRHIK-GRSAKSCRLRWCNQ 68
                     79*****************************9.***********985 PP

2Myb_DNA-binding52.21.4e-1677117345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++t Ede +++a++++G++ W+tIar ++ gRt++ +k++w+
    C.cajan_30414  77 PFSTREDEVILHAHARFGNK-WATIARLLP-GRTDNAVKNHWN 117
                      79******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.5981873IPR017930Myb domain
SuperFamilySSF466891.09E-3021116IPR009057Homeodomain-like
SMARTSM007174.9E-152271IPR001005SANT/Myb domain
PfamPF002491.5E-162368IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-232476IPR009057Homeodomain-like
CDDcd001675.38E-132567No hitNo description
SMARTSM007174.2E-1374122IPR001005SANT/Myb domain
PROSITE profilePS5129418.55775124IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2177123IPR009057Homeodomain-like
CDDcd001671.33E-977120No hitNo description
PfamPF002492.3E-1377117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MKPSSSSSPR PNNNNNNNCY RIKGPWSAEE DRILTWLVEA HGPRNWALIS RHIKGRSAKS  60
CRLRWCNQLS PAVEHRPFST REDEVILHAH ARFGNKWATI ARLLPGRTDN AVKNHWNATL  120
KRRAPQRRRF ATERFEDDTF TALTLAPPGS FGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-39221243105MYB PROTO-ONCOGENE PROTEIN
1msf_C3e-39221243105C-Myb DNA-Binding Domain
1mse_C3e-39221243105C-Myb DNA-Binding Domain
1h89_C1e-382212457159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-382212457159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549412.25e-75PREDICTED: transcription factor MYB98-like
SwissprotQ9FDW11e-52MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A151RMH31e-110A0A151RMH3_CAJCA; Transcription factor MYB44
STRINGGLYMA17G36370.22e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-56myb domain protein 73